← back to all games

Downfall: A Story of Corruption

4.1 73 third-party ratings
Downfall: A Story of Corruption

Gallery

Game made by Aperture StudioLoving this game? Show the developer some love. Games like this are kept alive by their players, and every bit of support goes toward the next update or their next game.
Download this gamev0.16.0 · RPGM

Notice for the developer of Downfall: A Story of Corruption: anything on this page is meant to be your own free, public release. If that is not the case here, email us at contact [at] thegoonergames.com and we will edit the page or take it down. We take this seriously.

Copyright & Terms

The Gooner Games is a platform for free games. For Downfall: A Story of Corruption, the download links simply point to the developer's own public files, wherever they are: itch.io pages, free Patreon builds, the developer's official site, and other public sources. We do not host, repackage or modify any download.

Are you the developer and want this page removed or fixed? Two easy options: use our DMCA page, or just email contact [at] thegoonergames.com with proof you are the dev and tell us what to change. No paperwork needed, we will edit or remove it, no questions asked.

For visitors: every download link goes straight to the original file on its original host. We add nothing, change nothing, and inject nothing along the way.

Updated 1y ago·Engine RPGM

Downfall: A Story of Corruption by Aperture Studio is an RPGM corruption RPG. The protagonist starts an ordinary life that begins drifting darker through a sequence of choices the script never lets him fully walk back : each beat sliding into the next.

Comments

Loading comments…

You might also like

Tomie Wants to Get Married Expansion1/7

Tomie Wants to Get Married Expansion

Ollane
Unityv1.3801
3dcgahegaoanal sexanimatedbdsmblackmailbukkakecheatingcorruptioncreampiedating simdilfexhibitionismfemale protagonistfoot fetishfootjobgraphic violencegropinggroup sexhandjobhumiliationinternal viewinterraciallesbianmale dominationmasturbationmilfmobile gamemultiple endingsmultiple penetrationoral sexpregnancyprostitutionsandboxsex toyssleep sexspankingstrippingtitfuckurinationvaginal sexvirginvoyeurism
The Office Wife1/7

The Office Wife

Mike Cross Games (michaelcros)
Ren'Pyv0.93-hotfix
3dcganal sexanimatedblackmailcheatingcorruptioncreampiecuckoldexhibitionismfemale protagonistgropinggroup sexhandjobhumiliationinterraciallesbianmale dominationmasturbationmobile gamemultiple penetrationnetorareoral sexprostitutionsandboxsex toysspankingstrippingswingingtabootitfuckurinationvaginal sexvoyeurism
Secretary1/2

Secretary

Deedee
HTMLv1.1.2.6 (Vibes, Coded)
Play in browser
2dcgadventureahegaoanal sexanimatedbdsmblackmailbukkakecheatingcorruptioncosplaycreampiecuckolddating simdilfdystopian settingexhibitionismfemale dominationfemale protagonistfoot fetishfootjobfurryfuta/transfuta/trans protagonistgaygraphic violencegropinggroup sexhandjobharemhumiliationinterraciallactationlesbianmale dominationmale protagonistmanagementmasturbationmind controlmobile gamemonstermonster girlmultiple penetrationoral sexprostitutionreligionromancerpgsandboxsex toyssimulatorsissificationslavespankingstrippingswingingteasingtentaclestext basedtitfucktrainertransformationtrapurinationvaginal sexvirginvoyeurism
iNSight of You1/7

iNSight of You

AdventAnyx
Ren'Pyv1.0
3dcgahegaoanal sexanimatedbdsmbig assbig titsblackmailbukkakecorruptioncreampiecuckoldexhibitionismfemale dominationfemale protagonistgropinggroup sexhandjobharemhumiliationlesbianmale dominationmale protagonistmanagementmasturbationmultiple penetrationmultiple protagonistoral sexpoint & clickprostitutionromancesandboxsex toyssimulatorslavespankingstrippingswingingteasingtitfucktrainerurinationvaginal sexvirginvoyeurism
Wife Trainer Files1/4

Wife Trainer Files

WifeTrainer
Ren'Pyv0.7r
anal sexbdsmbig titsblackmailcheatingcorruptioncreampiecuckoldexhibitionismfemale dominationfoot fetishfootjobgaygroup sexhandjobharemhumiliationinterraciallesbianmale dominationmale protagonistmilfmind controlmobile gameoral sexpeggingprostitutionreal pornromancesandboxsex toysslavespankingstrippingswingingtabootrainertransformationurinationvaginal sex
FemLife1/7

FemLife

Mr_saturn
QSPv3.2.2
3dcganal sexanimatedbdsmbig assbig titsblackmailbukkakecheatingcorruptioncreampiecuckoldfemale protagonistfoot fetishfootjobgroup sexhandjobhumiliationinterraciallesbianmasturbationmultiple penetrationnetorareoral sexpregnancyprostitutionsandboxsex toysspankingtaboourinationvaginal sex