← back to all games

Earn Your Freedom

Earn Your Freedom

Gallery

Game made by SweetSissyDreamsLoving this game? Show the developer some love. Games like this are kept alive by their players, and every bit of support goes toward the next update or their next game.
Download this gamev0.21a · Ren'Py

Notice for the developer of Earn Your Freedom: anything on this page is meant to be your own free, public release. If that is not the case here, email us at contact [at] thegoonergames.com and we will edit the page or take it down. We take this seriously.

Copyright & Terms

The Gooner Games is a platform for free games. For Earn Your Freedom, the download links simply point to the developer's own public files, wherever they are: itch.io pages, free Patreon builds, the developer's official site, and other public sources. We do not host, repackage or modify any download.

Are you the developer and want this page removed or fixed? Two easy options: use our DMCA page, or just email contact [at] thegoonergames.com with proof you are the dev and tell us what to change. No paperwork needed, we will edit or remove it, no questions asked.

For visitors: every download link goes straight to the original file on its original host. We add nothing, change nothing, and inject nothing along the way.

Updated 3y ago·Status In development·Language English·Engine Ren'Py
Developer Notes

The game is in the early stage of development. I have a lot of content planned for the game with a lot of fetishes, possible actions (like different jobs players can choose from) and a lot of options to customize the character (clothes, hairstyles, makeup, plastic surgery, hormonal therapy, etc.). Also, I want the final game to have a non-linear story, where everything depends on the player choices.

Save Location:

**Where to put the save file:

Mac** - Users/Username/Library/RenPy/EarnYourFreedom

Win - C:/Documents and Settings/Username/Application Data/RenPy/EarnYourFreedom

or

C:/Documents and Settings/Username/AppData/Roaming/RenPy/EarnYourFreedom (Win 10)

Android - My files/internal storage/android/data/earnyourfreedom/saves tap "move file" and follow that.

Walkthrough:

  • intro, getting to the brothel
  • can suck boss's cock when you meet his for the first time, or refuse
  • choosing clothes, doesn't matter what you choose
  • end of the day, possibility to escape, if you choose "try to escape" it will lead you to a gangbang scene
  • day one, glory hole handjob scenes, after a first handjob scene if you choose any of the two options except "serve one more cock" you'll get one more scene with Ashley and a possibility to masturbate while covered in cum later in the day
  • after the glory hole an option to masturbate, you'll be able to do it again every evening until locked in a chastity cage
  • day two, you can visit different locations and look around, work at the glory hole again, doesn't matter what you do
  • day three, Alex visits to collect the weekly payment, resulting in a footfetish scene
  • next after that is a scene, where Alex puts on a chastity cage on MC's cock
  • after that, you can work in the gh booth if you like, travel around, visiting other locations, but to progress, you need to speak to Ashley
  • take a new hairstyle in the beauty salon
  • wait for a client in the room - handjob scene, after that a groping scene, if you choose an "ask him to stop" menu option, it will lead to a fingering scene
  • wait for a client again, nobody comes, MC realizes he needs to look more girlish
  • visit beauty salon again (need to have $50, you can get them by working in the gh booth) you will get some make up
  • after that - a prostate milking scene with Erika and new lips for the MC
  • after getting new lips, you can wait for a client in the room again, it will lead you to an anilingus scene and a blowjob scene
  • if you wait for a client again after that, it will lead you to a bj scene, that will repeat over and over in the 0.03 version if you choose "wait for a client"
  • you can also visit Erika again for hypno scene or a prostate milking again
  • if you get one more prostate milking, a vibrator becomes available for buying in the sex shop
  • if you have a vibrator, it will unlock a masturbation scene in the evening
  • with your money you can also buy new clothes
  • also, there is a final punishment scene, if you don't have enough money for Alex next time she comes to collect the payment
  • after the first blowjob in the room, blowjobs in the glory hole booth become available
  • after buying a vibrator from the sex shop, you need to make MC have some fun with it during the evenings (3 times)
  • on the third time you'll get some new scenes with with Alex
  • after the event if you wait for a client, you'll have an event with MC's past friend
  • after this event you are able to buy a dildo (white)
  • also after the event with Tom, gym becomes available
  • you can visit the gym and start training, but to do so, you need gym clothes, you can buy them in the clothes shop, (red shorts & blue top)
  • visit gym training five times to see all the scenes
  • if you visit a butt wall room, it's possible to trigger a random event with a "familiar" butt in the wall
  • after the event with deepthroating in the gym, one more blowjob scene in the glory hole becomes available, also there is a continuation of the events in the butt-wall room if you visit it couple of times more, and also you'll get to meet a new character
  • the next event at the gym is when Craig shows how to do crunches
  • after the crunches you need to have some fun with the dildo from the sex shop
  • if you've used it for a couple of times and did crunches for a couple of times with Craig, you'll get an event in the morning, saying that you've trained for a while already, but there are no visible results, after that you should talk to Craig about it
  • he will propose you more intense trainings
  • do 2-4 intense trainings and you'll get another event when you wake up in the morning with first body transformation
  • after this, gym becomes optional, only if you want the player to get breasts, then you need to do 2-4 intense trainings more

after the first body transformation, Ashley will come to your room in the late evening and will invite you to hang out together in her room

  • now you can visit her every evening
  • after this you need to spend three evenings with her, to get a threesome event
  • after this you can continue spending time with her, but there are no major events at this point
  • after a threesome event if you press "wait for a client button, you'll get visited by Tom for the second time, and will meet another new character.

Ver 0.06

  • After talking to Sophie in the butt-room wall, you'll be able to but a maid uniform from the clothes shop and when you have it on, you can work as a maid in the B-W room
  • During the first working day you'll have to choose which ass to clean first, no drastic content differences, so you can choose whatever you like more
  • During the second day at work there will be an event with a random man, who will want to fuck MC, you'll have an option to refuse (a punishment event will follow) or you can obey and get fucked (fucking event will follow), after this, the events in this location will go in the loop and you can replay them and make a different choice
  • After unlocking scene #29 (fifth event with Craig) you'll get more random clients in the room
  • After the threesome event with Ashley, you'll be able to play through more new events with her, you'll get a notification when you'll unlock all of them
  • After one of the new events with Ashley, you'll get a notification that you can ask Alex to release you from the chastity cage, so during the next time she comes to collect the weekly payment, you can ask her about it.
  • If you ask her about it, you'll get a possibility to buy a slut outfit and work at the street, there will be three more new events there

Ver 0.07

  • after completing all the events from the previous version, you'll have access to new random clients
  • fist one is a woman who wants to get fucked with a strap-on, you can trigger this event if you press "wait for a client" while at the MC's room. The clients come in sequence and to unlock the woman you'll need to play through them.
  • same goes with the next random client - foot fetish guy and also you'll be able to choose an option to see a cum eating event with self feet licking.
  • You can find the other random client while working at the street if you choose the third menu option "offer yourself to the passing people". There are two events with this option - the first one is a car bj from the previous update and the second one is the new one (anal sex at the back seats of the car with a creampie).
  • After opening these events, the next evening you'll get visited by Alex and she'll tell you about the New Year party.
  • All the New Year special events will follow right after her visit.
  • The next morning she'll visit you again and will tell you about the "Sissy School"
  • After that, the school location will be unlocked and you'll be able to visit it from the elevators area.
  • If you visit the school you'll have an option to play through the humiliation and pet play scenes

Ver 0.08

  • Get visited by Alex on Sunday, she'll let MC out of the cage
  • Visit Erika and ask to increase your clit (don't worry if you don't want it bigger, it might even become smaller after this)
  • Go to the butt room and look for someone to fuck
  • You can have sex or not with a woman there
  • Next day visit the room again
  • Have an option to have sex with Sophie
  • If you do, cum eating scene
  • In the evening visit Ashley, can have sex with her
  • An option to get fucke in the mouth by her
  • If you chose to get face-fucked, next morning one more scene while she sleeps
  • Meet yoga instructor Valerie in the gym
  • Can do yoga with her
  • New t-shirt gets unlocked
  • Wear the t-shirt to tease her, the bigger the breasts, the better the result
  • It's possible to modify breasts size in the lab
  • Get hate-fucked by Valerie after teasing
  • After 3-4 stretching trainings, MC will be able to suck own clit in the evening
  • Visit Erika in the lab, get an injection test proposition from her
  • Agree to try it out
  • During the night a strange dream
  • A day later MC wakes up really horny, wait for a client in the room
  • Also, if you lock MC's clit back into the chastity cage, you can go to Erika for "cum donation" and get milked by her and fucked with a strap-on
  • Also, at any moment you can change MC's hair

v0.09

  • Depending on your actions in the previous version content you can get one of the three outcomes:
  1. a bigger clit: you need to fuck a woman in the butt-room, sophie and Ashley and you can only let MC eat cum once, after fucking Sophie, so you'll need to refuse giving a bj to Ashley. Also, you'll need to pay Alex to stay without the cage extra 3 days
  1. keep the clit the same size as it was: do the same, but don't pay Alex and get a cage after 4 days
  1. a smaller clit: just do something extra, like eating some more cum or giving a bj to Ashley or just fuck less than 3 persons
  • After seeing the result of your actions, you get a new sex toy (double-sided dildo unlocked) so you can buy it and use with Ashley in the evening
  • If you got the "test injection" from Erika and didn't get fucked by a client while you were waiting for the clit injection to work, the next time you wait for a client after the clit injection takes effect will trigger the sex scene with lactation
  • You can visit Sissy School and choose an option "Sissy's place" to get a SPH event
  • Right after completing it, the next option will get unlocked and you'll be able to play through the cock/balls worship event
  • If you've had a pegging scene with yoga trainer Valerie, you'll need to have one more training session with her while wearing a blue top that reveals MC's breast to tease Valerie, after that she will force MC to eat her pussy which will result in a squirting scene
  • If you chose to go to work at the street in the evening and pick the first option from the menu of what to do there, some random men will ask MC to show them breasts
  • If you choose a third option from the menu of what to do at the street, one of the clients will take MC away from the brothel to another street and they'll have anal sex on the car hood
  • After that you'll get a choice what to do, to go back to the brothel or to find one more client. If you choose the first option, nothing will happen, and if you choose the second one, MC will meet some sluts from another brothel
  • They will tie up MC to a street poll and you'll be able to choose, to beg them to let you go or to stay silent, if you'll choose to beg them, they will gag MC with their dirty panties and will leave, after that MC will get fucked all night long by the passing men, and if you'll choose to stay silent, the fucking scene will follow right away without the panties gagging
  • Also the glory hole scene will get available to play through
  • After you play through the gh anal scene MC can randomly get visited by a married couple if you wait in the room for a client
  • If you decide to go back down to the butt-room after the clit injection takes effect, Sophie will force MC to a human toilet, so a piss fetish scene will follow
  • If you've had a lactation scene with one of the clients, you can visit Erika and speak with her about it, she'll propose you to do some testing after she gets ready for it and a week after that if you visit her again, you'll get a fucking machine scene and a breasts milking scene

ver0.10

  • After getting visited by a married couple and having sex with them, Alex will come to MC's room on a Thursday morning and will tell that the couple would like MC to become their sexy maid.
  • If you agree, every Thursday morning you'll be able to go to their mansion and work for them
  • The first even will be MC getting plugged by Ada and then cleaning their kitchen
  • After that, the next time you visit them you'll be presented with a choice: 1) To work hard, 2) To tease, 3) To work normally.
  • If you play through option one 2-3 times, Ada will decide to reward MC, and you'll get a foot fetish/masturbation/cum eating/femdom event
  • If you choose option two, MC will get fucked on the kitchen counter
  • And if you choose option three, nothing special will happen
  • After getting milked by a milking machine in the Erika's lab, MC will be able to meet a new character Martin through the option "wait for a client"
  • You'll get a massage/teasing/footjob/denial event with him
  • After playing through the event with Martin, one of the mornings MC will get visited by Alex and she will tell that Boss is waiting for MC in his office
  • MC will go there right away and Boss will demand a blowjob
  • You can agree or refuse, if you agree to do it, MC will get a possibility to suck his dick every day and if you do it for 2-3 times, Boss will decide to reward MC and this will lead to a sex scene with Alex
  • Also after the event with Martin, you'll be able to ask Alex to take off the chastity cage when she visits you to take the weekly payment
  • You'll have to decide if you agree to her conditions and if you do, this will allow you to get free from chastity for two days a week
  • When you get free from the cage, press "wait for a client" and MC will be visited by Naomi
  • After getting fucked by Naomi, if you choose to wait for a client while MC is caged, you'll get a chance to get a sex scene, where MC is roughly fucked in a full nelson pose
  • After playing through the event where MC gets tied to a street pole by the other sluts, if you decide to work at the street and choose option 3 (proposing the passing strangers to fuck you), MC will meet Victoria and she will take her to her porn studio, where you will be able to get a gang bang porn scene

ver0.12

  • You'll get visited by Adrienne randomly while MC is in the room and is wearing her clitty cage and it will lead you to the teasing/humiliation event and then foot worship/masturbation event
  • While working as a maid for the couple, choose the option "Just work normally" and you'll randomly encounter the foot fetish event
  • While working in the butt-room you can randomly find an open booth, and if you explore is, it will lead you to a long day of fucking by random people and then getting castration threats from Alex
  • While working on the street, choose option #3, where MC proposes sex actively and she can get arrested by police, they take MC to the police station for some gang bang fun
  • You can meet Jennifer while you are outside of MC's room (elevators area) and she will propose MC to sleep together
  • After you sleep together, try inviting her as often as possible, especially while MC is without the cage, so the "jerk off" options are available. Jennifer will be busy from time to time, but I set the probability for that quite low, so there shouldn't be much grinding.
  • As soon as MC jerks off and cums on Jennifer, you can get visited by Naomi when you choose to wait for clients (if you chose the dominant path, she'll only visit if MC is without the cage)
  • After that, you'll get a threesome event depending on the path that you've chosen.
  • After having a threesome with Jennifer, you will be able to cum on her feet while she's sleeping (this can be done while without the cage also) and it will lead you to a pegging event after Jennifer is angry at MC for 3-5 days. Then she'll come down and will visit MC if you choose to go to sleep at night.

ver0.13

  • The new event with Martin becomes available in about a week after his first visit, while MC is not wearing the cage
  • Continuation of the Adrienne NTR events. She will visit MC while in the room, in about a week after her first NTR event, if MC agrees to pay for her visits.
  • The gangbang event becomes available after playing through the police station fucking event and after watching Jennifer getting fucked in her room by two men
  • Train ride home even. After football gangbang event choose to go back by subway instead of walking.
  • After licking Alex's feet for the first time, you'll be able to visit Alex during the day to worship her feet in exchange for lowering the pay for the current week. To find her, click on the boss's office button from the elevator area menu.
  • Maid piss event. Choose the option to work normally and you'll be called by Master.
  • Finding Adrienne's sexy panties in the room and jerking off with them. Go to sleep while without the cage, after Adriens second NTR visit.
  • New random client that fucks MC while her little clitty is hanging limp and leaking non-stop :3 Press "wait for a client" while MC is not wearing the cage.
  • Submissive path during the first Tom encounter. You'll be able to choose to agree to get fucked by Tom.
  • Getting kidnapped by some mysterious men and getting used as a sex toy. Will be available after unlocking all the previous events in the list (excluding the Tom event). You need to go work as a street whore and choose option #3 (offer yourself to people)

ver0.14

  • After seeing a scene with Boss/Lexa threesome, wait in your room for Alex & Lexa to visit (they will visit only if MC is caged)
  • After the threesome with Alex & Lexa, you can visit Lexa through the boss location button and worship her dick
  • Adrienne will visit again in about a week after her previous visit (you just need to wait for a client)
  • MC will be invite on a date with Martin some time after the roof dinner event
  • To unlock black dildo and butt plugs, visit sissy school and play through the enema basic training and then anal stretching training (3-5 times)
  • After that you'll be able to buy butt plugs and the black dildo in the sex shop
  • You'll be able to change the plug from MC's room (button on the right side of the screen - Anal plugs)
  • You'll be able to play with the new didlo when MC is about to go to sleep
  • Visit the lab and choose Hypno C.U.M. to see the new cum hypno events
  • After unlocking all the previous events, you'll get visited by a client with a small dick. IF you choose to worship his dick, the event will continue. But if you'll choose to laugh, MC will get punished by Alex and will be forced to get an injection that will make his clitty smaller than it ever was (and cuter) :3

ver0.15

  • If you've chosen to laugh at the client's small dick, after getting punished with a shrinking injection, you'll have an option to rub your new tiny clitty
  • Amanda will visit you in your room on Wednesday during the day after you've fucked her in the fuck-wall room and after the threesome event with Alex & Lexa
  • The street whore event can be accessed after choosing the option "Wait near the road showing off your legs and ass". If you'd like to also get the piss event, you'll need to name the lowest price for your service ($50)
  • New sissy school class can be accessed after going through the basic enema class
  • You'll be able to work as Boss's secretary after playing through all the under-table blowjob events at his office and after meeting Lexa for the first time
  • The new random client will visit you if MC is not caged and after you've played through the anal glory hole event
  • Hucow events will be available after getting the test injection from Erika, lactating for the first time, and getting milked by her at least 3 times. After that, if you have the biggest breasts available, she'll offer you to go to the farm during weekends

ver0.16

  • To get the creampie eating event with Adrienne, you need to wait for a client in MC's room. For this event to get triggered, her previous event has to be unlocked.
  • To get the new event with Amanda, MC has to go to sleep by choosing the option "Go to sleep". Can be triggered after around 5 days after the previous event with Amanda
  • Farm events can be unlocked after about 3-4 travels to the farm total
  • Fuck-wall event will be unlocked after MC repeatedly chooses to spend time in the fuck-wall booth getting fucked (around 3 times) during her clean-up maid workday
  • Jennifer's event with own cum clean up can get unlocked if you cam on her ass in the morning 2-3 times. Anal creampie clean up even can be unlocked after it, if you visit her in the evening and get an option to peek into her room
  • Naomi's POV blowjob even will be available in about 5-7 days after her previous visit, and you'll have to "wait for a client" in your room
  • New street whore event can be unlocked if you've unlocked the previous street whore events and choose an option to "stand seductively". The new event has two options on how MC can act and can be repeated to get both of the options unlocked

You play an 18-year-old kid snatched by the wrong people and pushed into a brothel to work off his father's debts. The dev poses the question pretty directly: does he hold on to who he is, or eventually settle into being an obedient little slut?

Earn Your Freedom is a gay sandbox VN that runs on corruption, transformation and sissification systems where every choice tilts him further toward submission, or away from it.

Comments

Loading comments…

You might also like

Secretary1/2

Secretary

Deedee
HTMLv1.1.2.6 (Vibes, Coded)
Play in browser
2dcgadventureahegaoanal sexanimatedbdsmblackmailbukkakecheatingcorruptioncosplaycreampiecuckolddating simdilfdystopian settingexhibitionismfemale dominationfemale protagonistfoot fetishfootjobfurryfuta/transfuta/trans protagonistgaygraphic violencegropinggroup sexhandjobharemhumiliationinterraciallactationlesbianmale dominationmale protagonistmanagementmasturbationmind controlmobile gamemonstermonster girlmultiple penetrationoral sexprostitutionreligionromancerpgsandboxsex toyssimulatorsissificationslavespankingstrippingswingingteasingtentaclestext basedtitfucktrainertransformationtrapurinationvaginal sexvirginvoyeurism
Hero Party Must Fall1/7

Hero Party Must Fall

nitrolith
Ren'Pyv0.5.4
2d game2dcgahegaoanal sexanimatedbdsmbig assbig titsblackmailcheatingcorruptioncreampiecuckoldexhibitionismfemale dominationfoot fetishfootjobgaygropinggroup sexhandjobharemhumiliationinternal viewinterraciallactationlesbianmale dominationmale protagonistmasturbationmilfmonster girlmultiple penetrationoral sexpregnancyromancesex toyssissificationspankingswingingteasingtitfucktrainertrapvaginal sexvirginvoyeurism
Tales of Androgyny1/7

Tales of Androgyny

Majalis
Javav0.3.68.5
2dcgadventureahegaoanal sexanimatedbdsmbig assbig titsbukkakecharacter creationcombatcorruptioncreampieexhibitionismfantasyfemale dominationfemboyfoot fetishfootjobfuta/transgaygiantessgroup sexhandjobhumiliationhumorinternal viewinterraciallesbianmale protagonistmasturbationmind controlmobile gamemonster girlmultiple endingsmultiple penetrationoral sexpossessionpregnancyprostitutionromancerpgsex toyssissificationslavesleep sexspankingstrippingteasingtentaclestitfucktrapturn based combaturinationvaginal sexvirginvoyeurism
Degrees of Lewdity1/5

Degrees of Lewdity

Vrelnir
HTMLv0.5.9.7
Play in browser
2dcganal sexanimatedblackmailcharacter creationcheatingcombatcorruptioncreampieexhibitionismfemale dominationfemale protagonistfoot fetishfootjobfuta/transfuta/trans protagonistgaygroup sexhandjobhumiliationimpregnationinternal viewinterraciallactationlesbianmale dominationmale protagonistmind controlmobile gamemonstermonster girlmultiple penetrationoral sexpregnancyprostitutionsandboxschool settingspankingstrippingtentaclestext basedtitfucktransformationtrapturn based combatvaginal sexvoyeurism
Wife Trainer Files1/4

Wife Trainer Files

WifeTrainer
Ren'Pyv0.7r
anal sexbdsmbig titsblackmailcheatingcorruptioncreampiecuckoldexhibitionismfemale dominationfoot fetishfootjobgaygroup sexhandjobharemhumiliationinterraciallesbianmale dominationmale protagonistmilfmind controlmobile gameoral sexpeggingprostitutionreal pornromancesandboxsex toysslavespankingstrippingswingingtabootrainertransformationurinationvaginal sex
White Boy Summer
81 MB
1/7

White Boy Summer

PallasManul
Ren'Pyv1.0
3dcgahegaoanal sexanimatedbbcbig assbig titsbukkakecheatingcreampiecuckolddating simexhibitionismfantasyfemale dominationfoot fetishfootjobfurryfuta/transgaygropinggroup sexhandjobhumiliationhumorinterraciallactationmale dominationmale protagonistmilfnetorareoral sexpovpregnancyprostitutionreligionromancesandboxschool settingsex toyssissificationstrippingteasingtitfuckurinationvaginal sexvirginvoyeurism