← back to all games

Caught By My Futa Sister

3.7 3 ratings on itch.io
Caught By My Futa Sister

Gallery

Game made by Purple PulseLoving this game? Show the developer some love. Games like this are kept alive by their players, and every bit of support goes toward the next update or their next game.
Download this gameRen'Py

Notice for the developer of Caught By My Futa Sister: anything on this page is meant to be your own free, public release. If that is not the case here, email us at contact [at] thegoonergames.com and we will edit the page or take it down. We take this seriously.

Copyright & Terms

The Gooner Games is a platform for free games. For Caught By My Futa Sister, the download links simply point to the developer's own public files, wherever they are: itch.io pages, free Patreon builds, the developer's official site, and other public sources. We do not host, repackage or modify any download.

Are you the developer and want this page removed or fixed? Two easy options: use our DMCA page, or just email contact [at] thegoonergames.com with proof you are the dev and tell us what to change. No paperwork needed, we will edit or remove it, no questions asked.

For visitors: every download link goes straight to the original file on its original host. We add nothing, change nothing, and inject nothing along the way.

Updated 2mo ago·Status Released·Engine Ren'Py

Caught By My Futa Sister by Purple Pulse is the kinetic novel that the title is upfront about. The protagonist is caught somewhere he should not be, by exactly the person who would make the most of it, and the script does not pretend otherwise.

3DCG, female-domination scenes with a futa/trans lead, blackmail as a recurring motif, ahegao, incest undertones, exhibitionism and masturbation beats. Pay-what-you-want on itch with Win / Mac / Linux builds.

Comments

Loading comments…

You might also like

Power Vacuum1/7

Power Vacuum

What? Why? Games
Ren'PyChapter 12 Official
3dcgahegaoanal sexanimatedbig assbig titsblackmailcorruptioncreampiecuckoldexhibitionismfemale dominationfuta/transgropinggroup sexharemhumiliationhumorinterracialkinetic novellactationlesbianmale protagonistmasturbationmilfmobile gamenetorareoral sexpoint & clicksandboxtabooteasingvaginal sexvirgin
iNSight of You1/7

iNSight of You

AdventAnyx
Ren'Pyv1.0
3dcgahegaoanal sexanimatedbdsmbig assbig titsblackmailbukkakecorruptioncreampiecuckoldexhibitionismfemale dominationfemale protagonistgropinggroup sexhandjobharemhumiliationlesbianmale dominationmale protagonistmanagementmasturbationmultiple penetrationmultiple protagonistoral sexpoint & clickprostitutionromancesandboxsex toyssimulatorslavespankingstrippingswingingteasingtitfucktrainerurinationvaginal sexvirginvoyeurism
Photo Hunt1/7

Photo Hunt

Moochie
Ren'Pyv0.20.2 Extra
3dcganal sexanimatedbig assbig titsblackmailcheatingcorruptioncosplaycreampiecuckoldexhibitionismfemale dominationfoot fetishfootjobgropinghandjobharemhumiliationhumorinterraciallesbianmale dominationmale protagonistmasturbationmilforal sexprostitutionromancesandboxschool settingsex toysspankingstrippingswingingtabooteasingtitfuckvaginal sexvirginvoyeurism
Hail Dicktator1/7

Hail Dicktator

Hachigames
Unityv0.93.1
3dcganal sexanimatedbdsmbig assbig titsblackmailcorruptioncosplaycreampiedating simexhibitionismfemale dominationfemale protagonistfoot fetishfootjobgropinghandjobharemhumiliationhumorkinetic novellesbianmale dominationmale protagonistmanagementmasturbationmobile gamemultiple protagonistoral sexromancesandboxsex toysspankingsuperpowersteasingtitfucktrainervaginal sexvirginvoyeurism
Sword Art Online: The Trap of Breath Concealed Magic
259 MB
1/7

Sword Art Online: The Trap of Breath Concealed Magic

Fujino
RPGMv6 Beta
2d game3dcgadventureahegaoanal sexanimatedbbcbdsmbig assbig titsblackmailcheatingcorruptioncosplaycreampiecuckoldexhibitionismfemale dominationfoot fetishfootjobgropinghandjobharemhumiliationhumorinternal viewinterracialjapanese gamemale dominationmale protagonistmilfmind controlmonstermonster girlmultiple endingsnetorareoral sexparodypuzzlesandboxschool settingsex toysslavesleep sextabooteasingtitfuckturn based combatvaginal sexvoyeurism
UFO1/7

UFO

17MOONKEYS
Ren'PyCh.4 v0.8.3
3dcgadventureahegaoanimatedbbwbig assbig titscorruptioncreampieexhibitionismfemale dominationfuta/transgraphic violenceharemhumorkinetic novellactationmale protagonistmasturbationmilfmobile gamemonstermonster girloral sexparanormalparodypregnancyreligionromancesci-fishotasleep sextabooteasingtransformationvaginal sexvirginvoyeurism