AI Girlfriend

CONTROL & FUCK YOUR DREAM SLUTShe does whatever you wantCreate Her FreePick her looks & bodyUncensored chat 24/7Live every fantasy

← back to all games

3dcg ahegao anal sex big ass big tits blackmail creampie exhibitionism female domination futa/trans humiliation kinetic novel male protagonist masturbation oral sex taboo teasing

Caught By My Futa Sister v1.0

★ 3.7 3 ratings on itch.io

Gallery

Caught By My Futa Sister

Caught By My Futa Sister

Caught By My Futa Sister

Caught By My Futa Sister

Caught By My Futa Sister

Caught By My Futa Sister

Caught By My Futa Sister

Game made by Purple PulseLoving this game? Show the developer some love. Games like this are kept alive by their players, and every bit of support goes toward the next update or their next game.

Download this gamev1.0 · Ren'Py

DownloadWindowsitch.io DownloadmacOSitch.io DownloadLinuxitch.io

Notice for the developer of Caught By My Futa Sister: anything on this page is meant to be your own free, public release. If that is not the case here, email us at contact [at] thegoonergames.com and we will edit the page or take it down. We take this seriously.

Copyright & Terms

The Gooner Games is a platform for free games. For Caught By My Futa Sister, the download links simply point to the developer's own public files, wherever they are: itch.io pages, free Patreon builds, the developer's official site, and other public sources. We do not host, repackage or modify any download.

Are you the developer and want this page removed or fixed? Two easy options: use our DMCA page, or just email contact [at] thegoonergames.com with proof you are the dev and tell us what to change. No paperwork needed, we will edit or remove it, no questions asked.

For visitors: every download link goes straight to the original file on its original host. We add nothing, change nothing, and inject nothing along the way.

AI Porn Generator

GENERATE ANY PORN YOU WANTType any fantasy and watch it come to lifeGenerate YoursAny fetish, any scenarioRealistic or anime styleReady in seconds

Updated 5mo ago·Status Released·Engine Ren'Py

Caught By My Futa Sister by Purple Pulse is the kinetic novel that the title is upfront about. The protagonist is caught somewhere he should not be, by exactly the person who would make the most of it, and the script does not pretend otherwise.

3DCG, female-domination scenes with a futa/trans lead, blackmail as a recurring motif, ahegao, incest undertones, exhibitionism and masturbation beats. Pay-what-you-want on itch with Win / Mac / Linux builds.

Comments

Loading comments…

You might also like

Power Vacuum

What? Why? Games

Ren'PyCh. 12 Official

3dcgahegaoanal sexanimatedbig assbig titsblackmailcorruptioncreampiecuckoldexhibitionismfemale dominationfuta/transgropinggroup sexharemhumiliationhumorinterracialkinetic novellactationlesbianmale protagonistmasturbationmilfmobile gamenetorareoral sexpoint & clicksandboxtabooteasingvaginal sexvirgin

iNSight of You

iNSight of You

3dcgahegaoanal sexanimatedbdsmbig assbig titsblackmailbukkakecorruptioncreampiecuckoldexhibitionismfemale dominationfemale protagonistgropinggroup sexhandjobharemhumiliationlesbianmale dominationmale protagonistmanagementmasturbationmultiple penetrationmultiple protagonistoral sexpoint & clickprostitutionromancesandboxsex toyssimulatorslavespankingstrippingswingingteasingtitfucktrainerurinationvaginal sexvirginvoyeurism

Come Home

Ren'Pyv1.04 Premium

3dcgahegaoanal sexanimatedbdsmbig assbig titsbukkakecheatingcreampiecuckolddating simexhibitionismfantasyfemale dominationfuta/transgaygropinggroup sexhandjobhareminterraciallesbianmale dominationmale protagonistmasturbationmilfmobile gamemonster girlmultiple endingsmultiple penetrationoral sexromancesandboxsex toysspankingstrippingswingingtabooteasingtitfuckvaginal sexvirginvoyeurism

Photo Hunt

Ren'Pyv0.21.1 Extra

3dcganal sexanimatedbig assbig titsblackmailcheatingcorruptioncosplaycreampiecuckoldexhibitionismfemale dominationfoot fetishfootjobgropinghandjobharemhumiliationhumorinterraciallesbianmale dominationmale protagonistmasturbationmilforal sexprostitutionromancesandboxschool settingsex toysspankingstrippingswingingtabooteasingtitfuckvaginal sexvirginvoyeurism

Hail Dicktator

Hail Dicktator

3dcganal sexanimatedbdsmbig assbig titsblackmailcorruptioncosplaycreampiedating simexhibitionismfemale dominationfemale protagonistfoot fetishfootjobgropinghandjobharemhumiliationhumorkinetic novellesbianmale dominationmale protagonistmanagementmasturbationmobile gamemultiple protagonistoral sexromancesandboxsex toysspankingsuperpowersteasingtitfucktrainervaginal sexvirginvoyeurism

UFO

UFO

Ren'PyCh.4 v0.8.3 Full Version

3dcgadventureahegaoanimatedbbwbig assbig titscorruptioncreampieexhibitionismfemale dominationfuta/transgraphic violenceharemhumorkinetic novellactationmale protagonistmasturbationmilfmobile gamemonstermonster girloral sexparanormalparodypregnancyreligionromancesci-fishotasleep sextabooteasingtransformationvaginal sexvirginvoyeurism

Sword Art Online: The Trap of Breath Concealed Magic

Sword Art Online: The Trap of Breath Concealed Magic

2d game3dcgadventureahegaoanal sexanimatedbbcbdsmbig assbig titsblackmailcheatingcorruptioncosplaycreampiecuckoldexhibitionismfemale dominationfoot fetishfootjobgropinghandjobharemhumiliationhumorinternal viewinterracialjapanese gamemale dominationmale protagonistmilfmind controlmonstermonster girlmultiple endingsnetorareoral sexparodypuzzlesandboxschool settingsex toysslavesleep sextabooteasingtitfuckturn based combatvaginal sexvoyeurism

Ripples

Ren'PyEpisode 9

3dcgadventureahegaoanal sexanimatedbig assbig titscosplaycreampieexhibitionismfemale dominationgraphic violencegropinggroup sexhandjobhumorlesbianmale dominationmale protagonistmasturbationmilfmobile gameoral sexromanceschool settingsci-fispankingstrippingtabooteasingtitfucktwinsvaginal sexvirgin

Good Girl Gone Bad

Good Girl Gone Bad

Ren'Pyv1.2 Jasmin DLC

2dcganal sexbbcbdsmbig assbig titsblackmailcheatingcorruptioncreampiedating simdilfexhibitionismfemale dominationfemale protagonistfuta/transgropinggroup sexhandjobhumiliationinterraciallesbianmale dominationmasturbationmilfmultiple endingsmultiple penetrationoral sexpoint & clickpregnancyromancesex toysstrippingtabooteasingtitfuckvaginal sexvoyeurism