← back to all games

Lexi

4.6 55 third-party ratings
Lexi

Gallery

Game made by ChatterboxLoving this game? Show the developer some love. Games like this are kept alive by their players, and every bit of support goes toward the next update or their next game.
Download this gamev0.052 · Ren'Py

Notice for the developer of Lexi: anything on this page is meant to be your own free, public release. If that is not the case here, email us at contact [at] thegoonergames.com and we will edit the page or take it down. We take this seriously.

Copyright & Terms

The Gooner Games is a platform for free games. For Lexi, the download links simply point to the developer's own public files, wherever they are: itch.io pages, free Patreon builds, the developer's official site, and other public sources. We do not host, repackage or modify any download.

Are you the developer and want this page removed or fixed? Two easy options: use our DMCA page, or just email contact [at] thegoonergames.com with proof you are the dev and tell us what to change. No paperwork needed, we will edit or remove it, no questions asked.

For visitors: every download link goes straight to the original file on its original host. We add nothing, change nothing, and inject nothing along the way.

Updated 8y ago·Engine Ren'Py
Change-Log

v0.052

Remerged all chapters

used a better quality compression method on all images (shrunk game size down a lot)

(Note: No new content in this build)

v0.051

fixed Lexi's hair back !!!

v0.05c

  • Since we've finished building the Character Bio page and added the points to it, I've removed the old HUD and replaced it with a button in place of the HUD that gets you to the Character bio page. When viewing a character's bio page, hitting Characters in the menu to the left will bring you back to the character listing page, and Resume will get you back to the game.
  • A bug was found on day 6 from v0.04 that ended the update too soon by kicking the player out to the main menu just after the bookstore, if the player chose not to go on a date with Chelsea. This was fixed. You may have to use a save from before the MC goes to bed the previous night to remedy the error.
  • About three months ago as I was working on v0.04, I had decided to release the base game (with still images instead of animations) to the $2 tier, and the game with animations to the $5 and up tiers. After talking with many players on Discord, they've expressed that they would rather get the full game, but have a delay for tiers below the $10 tier. So if I go with their suggestions, the $10 and up tier would get the game with animations on release day, and the $5 and $2 would have a delay. Obviously, I would use a much shorter delay for the $5 tier. I want to hear from more supporters on this before I make any changes. On this update, I'm going to release to everyone until I work out what would be fair and reasonable for all supporters.
  • This update takes us about halfway through Day 7. The main focus is Kaylee. We cover less time, but have a similar size update to the last update.
  • I'm gonna try to reduce the time between updates. This also means smaller but more frequent updates. I hate waiting for 2 1/2 to 3 months between updates. For the next update I'm gonna try for 8 weeks because I have to go to training for my day job for about a week. I'll try to reduce it even further from there. As support grows I intend my first purchase to be a new motherboard and CPU to speed up posing. Posing is the biggest delay. So any support you can spare is helpful and very appreciated.

v0.04c

This version fixes the lag issues in the animations. All image series animations that caused lag, were converted into movie files with greatly reduced load times. The animations should now play instantly.

v0.04

Lexi is back!

A few notes before you download.

  1. We were planning on 25 animations, but cut that to 22 due to quality issues with 3 of them. The good thing is that they were all 3 very minor animations.
  1. Some of the animations ended up as movie files to help with load times. However, most of them are coded animations that play as an image series at 30 - 60 fps. We did this to preserve quality. The trade of is load times. Depending on the speed of your machine you may have to give each animation a couple of seconds to load. Let us know what your experience is with this. If it becomes a problem we'll start making two versions, one with high-quality animations made from image series, and one with movie files that may not have as good of quality, but loads faster.
  1. Please don't use saves from v0.03 or before. I went back and added flags to every choice so that the game keeps track of them no matter how small the choice was. This will help with future updates.
  1. We removed the old points screen that listed all the points. I never liked the way it looked anyway. I replaced it with a character screen for each character. This screen shows their general information, relationship status, and recent thoughts.
  1. The GUI was redesigned.

That's it. We hope you like this update, and we're excited to be back.

Chatterbox

v0.03

This update takes us through Day 4, and has over 400 new images.

The volume of the sound effects can now be adjusted in the Preferences menu.

At times I use image sequences that are easy to miss if you click to fast. Starting in v0.03, I will note that the next click will be an image sequence by placing (seq) at the end of the dialog preceding the sequence.

v0.021c

  1. All the old Sarah images were replaced.
  1. Various typos were corrected.
  1. The issue causing the player not to get points after choosing Kaylee in the shopping scene was fixed.

Lexi by Chatterbox is a Ren'Py 3DCG VN. The protagonist takes on a roommate named Lexi and the cohabitation pulls his life sideways - every shared evening reshapes a part of his routine he thought was fixed.

Comments

Loading comments…

You might also like

Come Home1/7

Come Home

RJ Rhodes
Ren'Pyv1.01
3dcgahegaoanal sexanimatedbdsmbig assbig titsbukkakecheatingcreampiecuckolddating simexhibitionismfantasyfemale dominationfuta/transgaygropinggroup sexhandjobhareminterraciallesbianmale dominationmale protagonistmasturbationmilfmobile gamemonster girlmultiple endingsmultiple penetrationoral sexromancesandboxsex toysspankingstrippingswingingteasingtitfuckvaginal sexvirginvoyeurism
Stray Incubus1/7

Stray Incubus

IP Studios
Ren'PySeason 2 Chapter 3b
3dcgadventureahegaoanal sexanimatedbdsmbig assbig titscheatingcombatcorruptioncreampiefantasyfemale dominationfoot fetishfootjobgraphic violencegroup sexhandjobharemhorrorhumorinterraciallesbianmale dominationmale protagonistmasturbationmilfmobile gamemonstermonster girloral sexreligionromanceschool settingsex toysspankingsuperpowersteasingtransformationtrapvaginal sexvirginvoyeurism
SpaceCorpsXXX1/7

SpaceCorpsXXX

RanliLabz
Ren'PyS2 v3.1.1
3dcganal sexanimatedbdsmbig titsbukkakecheatingcorruptioncreampiedating simexhibitionismfemale dominationfemboyfurryfuta/transgaygropinggroup sexhandjobharemhumiliationhumorinternal viewinterraciallesbianmale dominationmale protagonistmasturbationmilfmonstermonster girlmultiple endingsoral sexparodypoint & clickpregnancyreligionromancesci-fisleep sexstrippingtabooteasingtitfucktransformationvaginal sexvirginvoyeurism
Lucky Paradox1/7

Lucky Paradox

Stawer
Ren'Pyv0.10.5
3dcgahegaoanal sexanimatedbig assbig titscheatingcosplaycreampiedating simexhibitionismfoot fetishfootjobgraphic violencegropinggroup sexhandjobharemhumorlesbianmale dominationmale protagonistmasturbationmilfmobile gameoral sexpoint & clickpovromancesandboxsex toysspankingtabooteasingtitfucktransformationvaginal sexvirgin
HS Tutor1/7

HS Tutor

TK8000
Ren'Pyv0.20.2
3dcgahegaoanal sexanimatedbig assbig titscreampiedating simexhibitionismgropinghandjobhareminterraciallesbianmale protagonistmasturbationmilfmobile gameoral sexprostitutionromancesandboxschool settingsex toysspankingstrippingtabooteasingtitfuckvaginal sexvirginvoyeurism
V.I.R.T.U.E.S.1/6

V.I.R.T.U.E.S.

NoMeme
Ren'Pyv17
3dcgahegaoanal sexanimatedbdsmbig assbig titscorruptioncosplaycreampieexhibitionismfemale dominationfoot fetishfootjobgropinggroup sexhandjobhareminterraciallactationlesbianmale dominationmale protagonistmasturbationmilfmobile gamemultiple endingsmultiple penetrationoral sexpregnancyromancesandboxschool settingsex toyssleep sexspankingtabooteasingtitfuckurinationvaginal sexvirginvoyeurism